Protein Info for Sama_2692 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF04266: ASCH" amino acids 6 to 103 (98 residues), 75.3 bits, see alignment E=2.9e-25

Best Hits

Swiss-Prot: 64% identical to Y5414_VIBPA: UPF0267 protein VPA1414 (VPA1414) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K09900, hypothetical protein (inferred from 100% identity to saz:Sama_2692)

MetaCyc: 48% identical to N4-acetylcytidine amidohydrolase (Escherichia coli K-12 substr. MG1655)
RXN-21270 [EC: 3.5.1.135]

Predicted SEED Role

"RNA-binding domain protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.135

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S938 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Sama_2692 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MHPTKITFYERFEPIILSGDKTITIRDEAESHYVPGTRVAVHTYETDRWFCDIEIGSVTP
IQFDALNEEHARQEHLSLKDLKAVIRDIYPELDSLYVIEYRLISASQAG