Protein Info for Sama_2687 in Shewanella amazonensis SB2B

Annotation: DEAD-box ATP dependent DNA helicase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF04851: ResIII" amino acids 24 to 188 (165 residues), 29.1 bits, see alignment E=1.3e-10 PF00270: DEAD" amino acids 25 to 193 (169 residues), 158 bits, see alignment E=2.8e-50 PF00271: Helicase_C" amino acids 230 to 338 (109 residues), 99.7 bits, see alignment E=1.8e-32

Best Hits

KEGG orthology group: K11927, ATP-dependent RNA helicase RhlE [EC: 3.6.4.13] (inferred from 100% identity to saz:Sama_2687)

Predicted SEED Role

"ATP-dependent RNA helicase RhlE" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S933 at UniProt or InterPro

Protein Sequence (533 amino acids)

>Sama_2687 DEAD-box ATP dependent DNA helicase (RefSeq) (Shewanella amazonensis SB2B)
MSFASLGLSAPILKALDHKGYKTPSPIQAQAIPVVLEGRDLLAAAQTGTGKTAGFTLPLL
ELLSQTQKAGPKQVRALILTPTRELAAQIADNITAYSKYLPLKSTVVFGGVGIGPQITTL
RRGIDILVATPGRLLDLHQQNAVSFHGLEILVLDEADRMLDMGFIHDIKRILKLLPAKRQ
NLLFSATFSPEIRTLAHGLLHNAAEVSVTPRNSAAESVKQWIVPVDKNQKPALLAELTRF
YRWQQVLVFCRTKHGANRLVRQMDAEGIKAAAIHGNKSQNARTQALADFKRGAIRMLIAT
DIAARGIDISELPNVVNFELPHVPEDYVHRIGRTGRAGASGEAASLVCNEEAKQLRDIER
LIKQSLPRKEFVGFEPVHGLPPSENQGKSKPGGSKQGAKPGNKSQGRKPQGQSRNAQPKQ
RQGSRAQEERSQQDKNPSRSEQPRRERRGNDQARSERPHSARAHGDKARSDNARSENGRS
DARTDSARNDKPRSDRPNTDRAASNKPRSGNRPQGQGQQRPRSSAKGGERNQG