Protein Info for Sama_2666 in Shewanella amazonensis SB2B

Annotation: spermidine synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details PF01564: Spermine_synth" amino acids 313 to 506 (194 residues), 101.2 bits, see alignment E=2.7e-33

Best Hits

Swiss-Prot: 68% identical to SPEE_SHEON: Polyamine aminopropyltransferase (speE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to saz:Sama_2666)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S912 at UniProt or InterPro

Protein Sequence (571 amino acids)

>Sama_2666 spermidine synthase (RefSeq) (Shewanella amazonensis SB2B)
MALAQDLPQPLTPAKHLGRLDDALLLGIMALLAGCGLIYEYLLSHYAGRILGAMEAAIYT
MIGLMIVAMGAGAFAARAIRNPFVGFALLELTVALLGASSVLFCAAAIGLTQRLPQVLAD
TFGLPPDLLPTGGFLGQIQQLMQYLPYLVGTLLGLLIGMEIPLIARVRQALSDEHLLHNA
GTIYGADYLGAGVGAAIWVGLMLAMDIQLAAALTASVNLLAGLAFILRFRTRLTGFTWLL
LGHILASFALLLLALKGPALEQDFNNLLYKDRVIYSPATRFQQLVFTERLRGKAPPVYSL
YLNGRLQFSTQDEAIYHGFLVWPAMMAATRHDRVLIIGGGDGMAARDVLRWQPDEVVLMD
LDEQLVRLFQSPAEDMPPRLSNALLTQNVGALQDPRLTLVFDDAFNGVDRLIEAGRHFDV
VIVDLPDPSHPDLSKLYSDLFYRKLKELLSHDGAIAIQSTSPWHATRAFLSVGNTLESAG
FNIARYHQNVPSFGEWGWTLGTLSGSAKDKVMAAEPMPHPWLSKEMISASFAFPPGFEER
ALAVDINRFGSQVIYQYHQEAWQEESGINLF