Protein Info for Sama_2629 in Shewanella amazonensis SB2B

Annotation: putative signal transduction protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 148 to 167 (20 residues), see Phobius details PF08668: HDOD" amino acids 41 to 166 (126 residues), 28.8 bits, see alignment E=4.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2629)

Predicted SEED Role

"FIG01057521: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8X5 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Sama_2629 putative signal transduction protein (RefSeq) (Shewanella amazonensis SB2B)
MTELEHQVFSQIRAIIANEEQVLGRRGILIPLKKAILADGDVRNVVDIVSSDPALAAHLL
WRSTTAHVGGAHNSKNRSLKDALIRLGQVNIYRYAFSFYLKERLDELPQPYKKLVLGYWR
LTESIAASAVDSLKDLVSNNIDPDEVQTLALFSVFGQMIALTAFAYLNAESDESFPLGII
KQIIDTQQQTLTLEAFDSLGLDEELKEEFMIAHNLRQTRNPNSAGLVLRRVLSMRGLLLN
PL