Protein Info for Sama_2610 in Shewanella amazonensis SB2B

Annotation: ornithine cyclodeaminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 129 to 146 (18 residues), see Phobius details PF02423: OCD_Mu_crystall" amino acids 16 to 314 (299 residues), 175.9 bits, see alignment E=5.1e-56

Best Hits

Swiss-Prot: 40% identical to YK01_SCHPO: Uncharacterized protein P11E10.01 (SPAP11E10.01) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 100% identity to saz:Sama_2610)

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8V6 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Sama_2610 ornithine cyclodeaminase (RefSeq) (Shewanella amazonensis SB2B)
MKIIDGNQVQQKLTFPPLVEALRQQLCRPFTMPQRQVYALSDTADNQHAFALLPAWDEES
IAVKAFTYLPDNPVKNPGCESLYSQILLFDRKTGVPQALIDGTSVTYWRTAATSALAASF
LARKDSSRLLMCATGNLAVYMALAHASVRPIREIRIWGRNTQKIDSTIATIRAQRTDIEV
TAANALQLDVPWADIISCATGSPTPLFPGEWVTPGTHTDFVGNHHKDCRECDSHLITNSQ
VYVDARLNVFSEAGELLIPVSEGRFSLDEVRAELSELCQGTALGRVNDKDITMFKSVGSA
LADLAGARLLFKMLQEQ