Protein Info for Sama_2607 in Shewanella amazonensis SB2B

Annotation: putative methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details PF02203: TarH" amino acids 2 to 133 (132 residues), 30.5 bits, see alignment E=6.7e-11 PF12729: 4HB_MCP_1" amino acids 4 to 179 (176 residues), 55.8 bits, see alignment E=9.1e-19 PF00672: HAMP" amino acids 208 to 260 (53 residues), 23 bits, see alignment 1.6e-08 PF00015: MCPsignal" amino acids 324 to 507 (184 residues), 160.1 bits, see alignment E=1e-50

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to saz:Sama_2607)

Predicted SEED Role

"Methyl-accepting chemotaxis protein, homolog 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8V3 at UniProt or InterPro

Protein Sequence (541 amino acids)

>Sama_2607 putative methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella amazonensis SB2B)
MNQLQIKHKMLLGFFIPVLLLIIVCGVSMSIMSKIEDGVLRIYNDRVVPLEDLKLIGDDY
AVSVIDAINKANAGGFSAEEARNGLIEAKKNIASRWDKYMSTELTADEQKLASQTQQLFA
PANQQIQLLIDKLSGKSGSVTGQFSADIIPLYQVIDPISGKVAELVTLQIHIADLEREQV
ETLHSSSLKWFIGLAVFAVLITSFFGVWVNRGVMTPVTEIRQKLRQIREKSDMTVSFTVF
RDDELGHIAKDLNGVVNHLKGILKNIAEAASTLGDSADELNEFTRQANDRMFKQQSETEQ
TATAMNEMTAAVAEVAQSSNSAAESARNADESAARGNSIVQQSISSMSVLASQIQGTAAV
IGELATESQNIGRVLDVIKSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLAQRT
SESTREIESMIESLQQGVKSAVNSMEQGIAQVDNANESTNAAGSALQDIVASVDSITQLN
THIATAADEQSCVAESINQSIIAISDIAQESTQAANDLSEAVHQLAQLAGHMRTQVGTFI
L