Protein Info for Sama_2596 in Shewanella amazonensis SB2B

Annotation: ribosomal-protein-alanine acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01575: ribosomal-protein-alanine acetyltransferase
  • amino acids 12 to 141 (130 residues), 110.3 bits, E=4e-36
• PF00583: Acetyltransf_1
  • amino acids 37 to 119 (83 residues), 71 bits, E=2.1e-23
• PF13673: Acetyltransf_10
  • amino acids 39 to 125 (87 residues), 48.1 bits, E=2.2e-16
• PF13508: Acetyltransf_7
  • amino acids 44 to 121 (78 residues), 54.1 bits, E=3.5e-18
• PF08445: FR47
  • amino acids 62 to 122 (61 residues), 45.6 bits, E=1.1e-15

Best Hits

Swiss-Prot: 48% identical to RIMI_ECOL6: [Ribosomal protein S18]-alanine N-acetyltransferase (rimI) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to saz:Sama_2596)

MetaCyc: 48% identical to protein N-acetyltransferase RimI (Escherichia coli K-12 substr. MG1655)
2.3.1.128-RXN [EC: 2.3.1.266]; 2.3.1.- [EC: 2.3.1.266]

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128 or 2.3.1.266

Sequence Analysis Tools

See A1S8U2 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Sama_2596 ribosomal-protein-alanine acetyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MKIEALGQHDAPNMAFIESEAHSHPMSEGALADCFGPLYRCSGLYRDDVLLGFAIVQQIV
DEATLFDICVLPSAQGKGLGKLLLEQVIADAQNHGAQVLMLEVRASNMAAIGLYQRLGFT
EIGRRKGYYPTIDGREDAVLMDLRLDTAD