Protein Info for Sama_2565 in Shewanella amazonensis SB2B

Annotation: hemK family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00536: methyltransferase, HemK family
  • amino acids 6 to 281 (276 residues), 276.4 bits, E=2.3e-86
• PF17827: PrmC_N
  • amino acids 9 to 78 (70 residues), 87.6 bits, E=3e-28
• TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific
  • amino acids 28 to 276 (249 residues), 295.9 bits, E=2.4e-92
• PF03602: Cons_hypoth95
  • amino acids 97 to 195 (99 residues), 27.4 bits, E=1.1e-09
• PF05175: MTS
  • amino acids 101 to 200 (100 residues), 70.4 bits, E=6.6e-23
• PF06325: PrmA
  • amino acids 112 to 188 (77 residues), 23.1 bits, E=2.2e-08
• PF13847: Methyltransf_31
  • amino acids 114 to 243 (130 residues), 54.7 bits, E=4.3e-18
• PF13649: Methyltransf_25
  • amino acids 118 to 194 (77 residues), 40.7 bits, E=1.4e-13
• PF08241: Methyltransf_11
  • amino acids 119 to 188 (70 residues), 30.2 bits, E=2.5e-10
• PF02384: N6_Mtase
  • amino acids 149 to 237 (89 residues), 24 bits, E=1e-08

Best Hits

Swiss-Prot: 74% identical to PRMC_SHEON: Release factor glutamine methyltransferase (prmC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to saz:Sama_2565)

MetaCyc: 54% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

See A1S8R1 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Sama_2565 hemK family protein (RefSeq) (Shewanella amazonensis SB2B)
MAAHSTIGEALQWGFSTLASSSTSANLDAEVLLQHCLGKNRTFLYTWPERPLTSEQWKHF
EQLINRRAKGVPVAHILGEREFWSLKFLVNETTLIPRPDTEMLVETALNLPLPDNARVLD
MGTGTGAIALALASERPNWRITALDKVDDAVALAKANREQLGLSQVEILQSDWFSAVRDA
DFDLIVSNPPYIDEHDEHLAMGDVRFEPLSALTAADEGYADLNHIAMHAREHLKVGGYLL
LEHGFAQALKLRETLVSLGYDKVATVRDFGSNDRCTLGLWHGEDA