Protein Info for Sama_2535 in Shewanella amazonensis SB2B

Annotation: Na(+)-translocating NADH-quinone reductase subunit E (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details TIGR01940: NADH:ubiquinone oxidoreductase, Na(+)-translocating, E subunit" amino acids 2 to 200 (199 residues), 342.2 bits, see alignment E=7.4e-107 PF02508: Rnf-Nqr" amino acids 4 to 200 (197 residues), 197.6 bits, see alignment E=8.7e-63

Best Hits

Swiss-Prot: 95% identical to NQRE_SHEDO: Na(+)-translocating NADH-quinone reductase subunit E (nqrE) from Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

KEGG orthology group: K00350, Na+-transporting NADH:ubiquinone oxidoreductase subunit E [EC: 1.6.5.-] (inferred from 100% identity to saz:Sama_2535)

MetaCyc: 80% identical to Na(+)-translocating NADH-quinone reductase subunit E (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit E (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8N1 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Sama_2535 Na(+)-translocating NADH-quinone reductase subunit E (RefSeq) (Shewanella amazonensis SB2B)
MEHYISLLIRSVFIENMALSFFLGMCTFLAVSKKVKTAMGLGVAVIVVLAISVPANQIIY
QGILAPGALAWAGVPEADLSFLKFITFIGVIAALVQILEMALDKYFPPLYNALGIFLPLI
TVNCAIFGAVSFMVERDYNLPESLVYGVGSGIGWALAIVLLAGIREKMKYADVPDGLRGL
GITFITAGLMALGFMSFSGVSL