Protein Info for Sama_2516 in Shewanella amazonensis SB2B

Annotation: gamma-glutamyl kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01027: glutamate 5-kinase
  • amino acids 9 to 371 (363 residues), 486 bits, E=3.8e-150
• PF00696: AA_kinase
  • amino acids 10 to 239 (230 residues), 157.9 bits, E=3.6e-50
• PF01472: PUA
  • amino acids 281 to 352 (72 residues), 68 bits, E=5.4e-23

Best Hits

Swiss-Prot: 100% identical to PROB_SHEAM: Glutamate 5-kinase (proB) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 100% identity to saz:Sama_2516)

MetaCyc: 64% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-N^δ-acetylornithine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

See A1S8L2 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Sama_2516 gamma-glutamyl kinase (RefSeq) (Shewanella amazonensis SB2B)
MNSSVQGYRRVVVKLGTSVLTSGSKSLDKAHMVELARQMAGLMKSGVEVVLVTSGAIAAG
REHLGYPVLPDTMANKQLLAAVGQSQLILAWSQLFSIYGLHVGQLLLTRADLHDRERYLN
ARDTLNALLAQGIVPIINENDAVATTEIKVGDNDNLSARAALLCDADLLMLLTDQKGLFD
ADPRKEPNARLIPEVEHIDDSLRLLAGGSVSGLGTGGMATKLQAADIARRAGVEVIIASG
HHPEVIKKAVHREAVGTRFLAIESPLESRKQWILAGPKAKGRLLLDIGAVAAVTCRGRSL
LSKGITGVEGQFERGDTLELVSPDGRVVARGMARYQSQALNLIAGKHSDEIEPLLGYDYG
DAVVHRNDMVVLEMIGEAK