Protein Info for Sama_2515 in Shewanella amazonensis SB2B

Name: proA
Annotation: gamma-glutamyl phosphate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 14 to 410 (397 residues), 531 bits, see alignment E=8.4e-164 PF00171: Aldedh" amino acids 20 to 272 (253 residues), 46.4 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 100% identical to PROA_SHEAM: Gamma-glutamyl phosphate reductase (proA) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 100% identity to saz:Sama_2515)

MetaCyc: 59% identical to glutamate-5-semialdehyde dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glutamate-5-semialdehyde dehydrogenase. [EC: 1.2.1.41]

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8L1 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Sama_2515 gamma-glutamyl phosphate reductase (RefSeq) (Shewanella amazonensis SB2B)
MDAQAYLLQLGQAAKSSGFALANLGVMAKNRLLGRVAAELKSAFDEILAANAKDVAAARA
SGLGDAMVDRLLLNDDRLKGIIADIDNVISLADPIGEEFDSRLLDNGMRLCRRRVPLGVI
GVIYEARPNVTVEIAVLALKTGNAVILRGGKETLESNLALAAAIRRALAGEGLPEDCVQL
IDNPDRALVTGLLKLDKFVDMIVPRGGQGLQRLCAEQATIPVILGGIGICHLYLDRDADI
SRAANVIINAKVQRPTVCNALDTLLIHRDKLDWLPTLARALQQQGVKLVACEQSLGALAA
AGIEAEAASDESFGTEWLSLTLGVKVVADIDEAIAHIRHYSSGHSEAILTDNLAAATHFM
NEVNSAAVYLNASTRFTDGGQFGFGAEVAVSTQKLHARGPMGLEALTTYKWLGVGDYSCR