Protein Info for Sama_2450 in Shewanella amazonensis SB2B

Annotation: glucose-1-phosphate adenylyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 17 to 389 (373 residues), 497 bits, see alignment E=1.6e-153 PF00483: NTP_transferase" amino acids 18 to 283 (266 residues), 203.3 bits, see alignment E=7.2e-64 PF24894: Hexapep_GlmU" amino acids 306 to 410 (105 residues), 145.7 bits, see alignment E=7e-47

Best Hits

Swiss-Prot: 100% identical to GLGC_SHEAM: Glucose-1-phosphate adenylyltransferase (glgC) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 100% identity to saz:Sama_2450)

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8E8 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Sama_2450 glucose-1-phosphate adenylyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MPNHSPRFISNLTRETYALILAGGRGSRLFELTDWRAKPALYFGGKFRVIDFPLSNCVNS
GIRRIGVVTQYQSHSLIRHVMRGWGHFKRELGESVEILPASQRYSESWYQGTADAVFQNI
DIIRHELPRYVMILSGDHVYRMDYAGMLAAHAQSGADMTVCCQEVPVAEAAGSFGVMEVA
EDMRVVGFEEKPANPSCLPHDPERCLASMGNYVFNTEFLFDQLRKDAENVSSERDFGKDI
IPSIIREHKVFAYAFKSGLGAGQDYWRDVGTLDTFWQANMELLSPEPHLNLYDAKWPIWT
YQEQLPPAKFVFDDEDRRGMATDSIVSGGCIISGAKVKRSVLFNEVRICSYSEVEGAVIL
PDVVVLRNCRLKNVIIDRGCVIPEGMVIGHNHDHDRARGFRVTDKGVVLITREMLGLPVG
FE