Protein Info for Sama_2328 in Shewanella amazonensis SB2B

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF01370: Epimerase" amino acids 33 to 164 (132 residues), 22.7 bits, see alignment E=9e-09 PF01073: 3Beta_HSD" amino acids 33 to 165 (133 residues), 24 bits, see alignment E=2.8e-09 PF02719: Polysacc_synt_2" amino acids 33 to 272 (240 residues), 153.7 bits, see alignment E=9.6e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2328)

MetaCyc: 77% identical to UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting) (Escherichia coli O108)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S827 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Sama_2328 UDP-N-acetylglucosamine 4,6-dehydratase (RefSeq) (Shewanella amazonensis SB2B)
MLELIGRQTELFEADLNVLSEQLSARVSEASFLVLGGAGSIGQAVVKEIFNRQPKKLHVI
DISENNLAELVRDLRSSYGYIQGDFQTFALDIGSLEYDAFIRHDGKYDYVLNLSALKHVR
SEKDPFTLMRMIDVNVFNTDKTIKQSIASGVKKYFCVSTDKAANPVNMMGASKRIMEMFL
MRHSEQITISTARFANVAFSDGSLLHSFNQRLQKQQPLVAPNDIKRYFVTPKEAGLLCLM
SCILGENRDIFFPKLNEALHLMTFADIAVKYLSARGFEPFECQSEDEARQLAATLPAQGK
WPCFFTASDTTGEKDFEEFFMAHETLDITRFQDLGIIKNDAVYQPELLDEFEIQIERMKS
AGQWSKAELVEVFTRMIPDFGHKETGKYLDSKM