Protein Info for Sama_2328 in Shewanella amazonensis SB2B

Annotation: UDP-N-acetylglucosamine 4,6-dehydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 33 to 164 (132 residues), 22.7 bits, E=9e-09
• PF01073: 3Beta_HSD
  • amino acids 33 to 165 (133 residues), 24 bits, E=2.8e-09
• PF02719: Polysacc_synt_2
  • amino acids 33 to 272 (240 residues), 153.7 bits, E=9.6e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2328)

MetaCyc: 77% identical to UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting) (Escherichia coli O108)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

• UDP-N-acetyl-β-L-fucosamine biosynthesis (1/4 steps found)
• UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
• CMP-diacetamido-8-epilegionaminic acid biosynthesis (3/7 steps found)
• CMP-pseudaminate biosynthesis (1/6 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (10/24 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

See A1S827 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Sama_2328 UDP-N-acetylglucosamine 4,6-dehydratase (RefSeq) (Shewanella amazonensis SB2B)
MLELIGRQTELFEADLNVLSEQLSARVSEASFLVLGGAGSIGQAVVKEIFNRQPKKLHVI
DISENNLAELVRDLRSSYGYIQGDFQTFALDIGSLEYDAFIRHDGKYDYVLNLSALKHVR
SEKDPFTLMRMIDVNVFNTDKTIKQSIASGVKKYFCVSTDKAANPVNMMGASKRIMEMFL
MRHSEQITISTARFANVAFSDGSLLHSFNQRLQKQQPLVAPNDIKRYFVTPKEAGLLCLM
SCILGENRDIFFPKLNEALHLMTFADIAVKYLSARGFEPFECQSEDEARQLAATLPAQGK
WPCFFTASDTTGEKDFEEFFMAHETLDITRFQDLGIIKNDAVYQPELLDEFEIQIERMKS
AGQWSKAELVEVFTRMIPDFGHKETGKYLDSKM