Protein Info for Sama_2317 in Shewanella amazonensis SB2B

Name: flgC
Annotation: flagellar basal body rod protein FlgC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR01395: flagellar basal-body rod protein FlgC" amino acids 4 to 137 (134 residues), 172.3 bits, see alignment E=3.2e-55 PF00460: Flg_bb_rod" amino acids 7 to 32 (26 residues), 35.1 bits, see alignment 9.9e-13 PF06429: Flg_bbr_C" amino acids 89 to 135 (47 residues), 52.6 bits, see alignment E=3.9e-18

Best Hits

Swiss-Prot: 47% identical to FLGC_SALTY: Flagellar basal-body rod protein FlgC (flgC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02388, flagellar basal-body rod protein FlgC (inferred from 100% identity to saz:Sama_2317)

Predicted SEED Role

"Flagellar basal-body rod protein FlgC" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S816 at UniProt or InterPro

Protein Sequence (137 amino acids)

>Sama_2317 flagellar basal body rod protein FlgC (RefSeq) (Shewanella amazonensis SB2B)
MSLFNIFNVSGSGMSAQSVRLNTTASNIANADSVSSSVDKTYRARHPVFEAELAKASQQQ
SARGVNVKGIVESDKPLQKEYNPDHPMADADGFIYKPNVNVMEEMADMISASRSYQMNVQ
VADTAKSMLMQTLRMGK