Protein Info for Sama_2297 in Shewanella amazonensis SB2B

Name: fliF
Annotation: flagellar MS-ring protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 453 to 475 (23 residues), see Phobius details TIGR00206: flagellar M-ring protein FliF" amino acids 31 to 563 (533 residues), 266.1 bits, see alignment E=4e-83 PF01514: YscJ_FliF" amino acids 58 to 229 (172 residues), 167.3 bits, see alignment E=3.4e-53 PF08345: YscJ_FliF_C" amino acids 262 to 431 (170 residues), 152 bits, see alignment E=1.6e-48

Best Hits

KEGG orthology group: K02409, flagellar M-ring protein FliF (inferred from 100% identity to saz:Sama_2297)

Predicted SEED Role

"Flagellar M-ring protein FliF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7Z6 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Sama_2297 flagellar MS-ring protein (RefSeq) (Shewanella amazonensis SB2B)
MSTDMIVSTDSGMSGVQQENKSGVLGNLGSADMLRQVTMILALAICLALAVFVMMWAQEP
EYRPLGKFEAQEMIQVLDVLDKNKIPYQVDFDVLRVPEDKYQDIRLLLSRNGVDAASTTN
QDFLSQDMGFGVSQRLEQARLKHSQEQNLARTIEELKSVSRAKVILALPKENVFARNQSK
ASATVVVTSRRGGLGQEEVDAIVDIVASAVQGLEPTRVTVTDSNGRLLNSGSQDGASARA
RRELELVKQKEAEYRAKVDAILMPILGPENYTSQVDVTMDFTAVEQTSKRFNPDLPAVRS
EMTLETQTSGEANMGIPGALSNQPPMESNIPQTLQEAQDKAQANGNSHREATRNYELDTT
ISHTRQQIGVVRRVSVSVAVDYKTGEANTEGQVNRVARTEAELANIRRLLEGAVGFSGQR
GDSIEVVTVPFMDQLVEEVPELPMWEQPWFWKAMKLASGSLAILVLILFVVRPLLKKLLL
TDKVDMPDDGRLGHELAEIEDQFAADTLGMLNASDAEYSYADDGSILIPNLHKDDDMIKA
IRALVANEPELSTQVVKNWLQQDNG