Protein Info for Sama_2280 in Shewanella amazonensis SB2B

Name: fliA
Annotation: flagellar biosynthesis sigma factor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF04542: Sigma70_r2" amino acids 16 to 88 (73 residues), 63.9 bits, see alignment E=2e-21 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 16 to 233 (218 residues), 100 bits, see alignment E=1.1e-32 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 16 to 234 (219 residues), 269.4 bits, see alignment E=2.7e-84 PF04539: Sigma70_r3" amino acids 98 to 138 (41 residues), 43.4 bits, see alignment 5.9e-15 PF08281: Sigma70_r4_2" amino acids 177 to 229 (53 residues), 29.7 bits, see alignment E=8.1e-11 PF04545: Sigma70_r4" amino acids 182 to 230 (49 residues), 59.9 bits, see alignment 2.7e-20

Best Hits

Swiss-Prot: 50% identical to FLIA_ECOLI: RNA polymerase sigma factor FliA (fliA) from Escherichia coli (strain K12)

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 100% identity to saz:Sama_2280)

MetaCyc: 50% identical to RNA polymerase sigma factor FliA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7X9 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Sama_2280 flagellar biosynthesis sigma factor (RefSeq) (Shewanella amazonensis SB2B)
MNKAAAYTSMESKTSIVEQYAPLVKRIAHHMLARLPASVQLDDLLQAGMIGLLEASAKFD
GGKGAKFETFAGIRIRGAMLDEIRKGDWVPRSVHRNQRRVAQVIDELEQELGRDARDTEI
AERLDMSMEEYHHILNDVSVGKIIGIEDLGVSHDVLVPDGEQTNDIYDDLAQSQFQQALA
DAIRQLPERDALVLSLYYDEALNLKEIGAILDVSESRVCQIHSQAMLRLKGKLKHWTQV