Protein Info for Sama_2254 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 5 to 24 (20 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 102 to 129 (28 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 202 to 228 (27 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 3 to 258 (256 residues), 32.6 bits, see alignment E=5.7e-12 PF14667: Polysacc_synt_C" amino acids 316 to 390 (75 residues), 31.9 bits, see alignment E=1.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2254)

Predicted SEED Role

"polysaccharide biosynthesis protein CpsL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7V3 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Sama_2254 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MNNIFYYSSTLVKALSSYLLVFIISNNYTSEELGVYFYYLAIASFLSVAIPLGINSYIER
LSYSNKKAKYIFSFAFSLVFLSTVIFTLILSIFSIFYESGDIRLIIFVVGLLSFYKAIEI
LLEAVLIVLQKYKAIFVYWIVVLSLYFVLMCIFWTQDLIMKIETLITIISIFMVVVCILI
SRSTGALIFLDVSQSLFNKFKYVNLSFTWNMFFVSLLNTGIAVVDRIILGAMQSKEVLAI
YSVCYMIVFSIHRFFSTPFCLKIAQSLYRSHDYRSYRQNVLSGLFYLLLFLSLIILTFYA
YFFKIFSIDRPSIFFLLVLALSVIVFFIYTSLVTILKLKYMQDTILKVNIFVFLSNIILN
LSLVPYFSLLGAAFSTLITYSLGLIYYSLVIFKLEKCFGE