Protein Info for Sama_2250 in Shewanella amazonensis SB2B

Annotation: acetoacetyl-CoA reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 4 to 192 (189 residues), 157 bits, E=6.4e-50
• PF08659: KR
  • amino acids 6 to 170 (165 residues), 54.3 bits, E=2.6e-18
• PF13561: adh_short_C2
  • amino acids 10 to 241 (232 residues), 173.4 bits, E=9.2e-55

Best Hits

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 100% identity to saz:Sama_2250)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (20/20 steps found)
• biotin biosynthesis I (14/15 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (5/5 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• polyhydroxybutanoate biosynthesis (2/3 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• acetyl-CoA fermentation to butanoate (4/7 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• ethylmalonyl-CoA pathway (2/11 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.36

Sequence Analysis Tools

See A1S7U9 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Sama_2250 acetoacetyl-CoA reductase (RefSeq) (Shewanella amazonensis SB2B)
MNTKAVVVTGATGGIGWTIAEYLMSLEYFVIGTTHRAPQSACEQWIEMADKRGVLIKYDS
NVDNLSIDTLIEVANGHSIYGLVNNLGITRDSSFKKMTSEQWKQVMDVNLFSVFSLTQCI
FNHMALSGSGRIVNISSVNAHRGQFGQVNYCAAKAGLLGFTKALSLEGAKSGITVNSVSP
GYTDTKMLSHIPTDILQSIKDSVPMKRLAKPIEIAHAVAFLLDDKSAYITGADIPVNGGL
HLS