Protein Info for Sama_2243 in Shewanella amazonensis SB2B

Annotation: phosphoglucosamine mutase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF02878: PGM_PMM_I" amino acids 3 to 131 (129 residues), 153.9 bits, see alignment E=4.3e-49 TIGR01455: phosphoglucosamine mutase" amino acids 6 to 447 (442 residues), 625.4 bits, see alignment E=2.5e-192 PF02879: PGM_PMM_II" amino acids 161 to 258 (98 residues), 71.1 bits, see alignment E=2e-23 PF02880: PGM_PMM_III" amino acids 262 to 369 (108 residues), 109.7 bits, see alignment E=1.8e-35 PF00408: PGM_PMM_IV" amino acids 377 to 447 (71 residues), 61.6 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 100% identical to GLMM2_SHEAM: Phosphoglucosamine mutase 2 (glmM2) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to saz:Sama_2243)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7U2 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Sama_2243 phosphoglucosamine mutase (RefSeq) (Shewanella amazonensis SB2B)
MSRKYFGTDGVRGKVGEFPITPDFAMKLGWAAGTVMAASGTKEVIIGKDTRLSGYMLESA
MEAGFCAAGVNVALTGPLPTPAIAYLTSTFRADAGVVISASHNPYYDNGIKFFSNTGTKL
TDEQELEIERLLVSAIEGGAMTCVASDKLGKVRRINDAAGRYIEFCKGTFPNSLSLTGLK
IVVDSAHGAAYHIAKNVYRELGAEVISINDKPDGININEHCGATHMDSLQTAVMIHEADL
GIALDGDADRLMMVDSKGQVIDGDALLYLLAKSAQQRGEQVSGVIGTLMSNLGFEQALAN
LGIPFKRAKVGDRYVVELLKETGWRLGGENSGHLLMLDFTTTGDAIVASLQVLRALLESG
AGLADAITELNMFPQVLINVRLNGNAAVGLSHPSVSDAVATAESALGNDGRVLLRKSGTE
PLIRVMVEAKDAVKANQYAELIADAVRAVFPA