Protein Info for Sama_2213 in Shewanella amazonensis SB2B

Annotation: response regulator receiver protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF00072: Response_reg" amino acids 11 to 120 (110 residues), 95.3 bits, see alignment E=6.8e-31 PF00158: Sigma54_activat" amino acids 150 to 316 (167 residues), 225.3 bits, see alignment E=9.6e-71 PF14532: Sigma54_activ_2" amino acids 151 to 321 (171 residues), 72.1 bits, see alignment E=1.4e-23 PF07728: AAA_5" amino acids 173 to 289 (117 residues), 29 bits, see alignment E=2.4e-10 PF02954: HTH_8" amino acids 406 to 446 (41 residues), 40.3 bits, see alignment 5.4e-14

Best Hits

Swiss-Prot: 48% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 100% identity to saz:Sama_2213)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7R2 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Sama_2213 response regulator receiver protein (RefSeq) (Shewanella amazonensis SB2B)
MSLETLTNIQVLIVDDEPHIGTVLMQLFELNGLNAEATTDPHLAISLIDRDWPGVVITDV
NMPGMDGISLLAQCIRIDADLPVVLLTGFGDIAMAVSALKQGAYDFLEKPFNNEHMLDVV
KRALEKRSLTLENRKLKKQLESHAIPGPRILGNSPGIVRLRNLIDMVVNTPADVLIEGET
GTGKELVARCLHDHSPRHQANFVAINCGAIPENLIESELFGAEAGAFTGIDKARVGKFEF
ANGGTLFLDEIESTPLSLQVKLLRVLEDRKVERLGSNKSIPLDIRVVAATKVDLKQLCDK
GEFRQDLLYRLNLVTIPIPPLKERREDIPLLFLHFARIASARYHKELIFPSAEHHARMTA
HDWPGNVRELRNLAERYVLLGAESAFAASLGGHAQLQSGMSLSQRVEFFERMLIEEALSH
NRGSIKQTMEQLELPRKTLYDKMRKYDLDRKHYLNDTQEEA