Protein Info for Sama_2211 in Shewanella amazonensis SB2B

Updated annotation (from data): alpha-ketoglutarate TRAP transporter, large permease component
Rationale: specific phenotype on a-ketoglutarate. A putrescine ABC transporter (Sama_2642:Sama_2638) is also important in this condition, which is not explained. This organism can also utilize succinate or fumarate (but not L-malate), which we do not have fitness data for these under aerobic conditions. This could also transport some C4 compounds.
Original annotation: C4-dicarboxylate transport protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 55 to 76 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 393 to 418 (26 residues), see Phobius details amino acids 426 to 451 (26 residues), see Phobius details PF06808: DctM" amino acids 7 to 451 (445 residues), 364 bits, see alignment E=5e-113

Best Hits

KEGG orthology group: K11690, C4-dicarboxylate transporter, DctM subunit (inferred from 100% identity to saz:Sama_2211)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7R0 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Sama_2211 alpha-ketoglutarate TRAP transporter, large permease component (Shewanella amazonensis SB2B)
MTIATLFLTLFLCMLLGMPIAIALGFSSMLTILLFSNDSLASVALKLYEATSEHYTLLAI
PFFILSSAFLSTGGVARRIIDFAMDSVGHIRGGLAMASVMACMLFAAVSGSSPATVAAIG
SIVIVGMVRAGYPQKFAAGVITTSGTLGILIPPSIVMLVYAAATEVSAARMFMAGLIPGL
LMGVLLMVAIYIVARIKNLPSRPFPGVKALSLSSAKAMGGLALIFIVLGSIYGGVASPTE
AAAVACVYAYLVAVFGYRDIGPLKEVPWRKEGEAILAAIVRNLLHVGLGLIKTPTDKEIR
NVVRDGAKVSIMLLFIIANAMLFAHVLTTERIPHIIAETIVGWGLPPWGFLIIVNLLLLA
AGNFMEPSAILLIMAPILFPIAVQLGIDPIHLGIIMVVNMEIGMLTPPVGLNLFVTAGIT
GRSIGWVIHACLPWLLLLLGFLVLITYVPQISLFLPEYLDSLRGFK