Protein Info for Sama_2210 in Shewanella amazonensis SB2B

Updated annotation (from data): alpha-ketoglutarate TRAP transporter, small permease component
Rationale: specific phenotype on a-ketoglutarate. A putrescine ABC transporter (Sama_2642:Sama_2638) is also important in this condition, which is not explained. This organism can also utilize succinate or fumarate (but not L-malate), which we do not have fitness data for these under aerobic conditions. This could also transport some C4 compounds.
Original annotation: C4-dicarboxylate transporter, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details PF04290: DctQ" amino acids 21 to 178 (158 residues), 75.6 bits, see alignment E=1.8e-25

Best Hits

KEGG orthology group: K11689, C4-dicarboxylate transporter, DctQ subunit (inferred from 100% identity to saz:Sama_2210)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7Q9 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Sama_2210 alpha-ketoglutarate TRAP transporter, small permease component (Shewanella amazonensis SB2B)
MISRIFGYFEEGVLNLLITLMTLLVFMEVIARFFFNTGFLWIQELTLTFCGWFVLFGMSY
GIKVGAHIGVDAFVKKLKPGARRISALLAVSICLIYCAMFLKGTWDYLSQIYHIGIGMED
LDVPSVLMKQMSEDFAWDVMRIDPEDPAIPLWISQSILLLGFVMLTWRFLELAVAIFRGT
SNGFSFHDEAKESMHLADEQSGANDNNNDGAKS