Protein Info for Sama_2184 in Shewanella amazonensis SB2B

Annotation: phage shock protein E (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00581: Rhodanese" amino acids 31 to 113 (83 residues), 73.3 bits, see alignment E=9.4e-25

Best Hits

KEGG orthology group: K03972, phage shock protein E (inferred from 100% identity to saz:Sama_2184)

Predicted SEED Role

"Phage shock protein E precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7N3 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Sama_2184 phage shock protein E (RefSeq) (Shewanella amazonensis SB2B)
MNPLAKVGQLALIGLMLILTSTLAIGQDKDAATAWKLIEQGAMLVDVRTPEEYAAGHIEG
AINIPYEEVAAEFAKRAIDKNTSVVLYCRSGRRSGVANEALNAAGFTQVYNGGGYETLAQ
SGKSGQSQK