Protein Info for Sama_2130 in Shewanella amazonensis SB2B

Annotation: anthranilate synthase component II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 TIGR00566: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase" amino acids 3 to 184 (182 residues), 180.6 bits, see alignment E=1.4e-57 PF00117: GATase" amino acids 5 to 184 (180 residues), 177.2 bits, see alignment E=3e-56 PF07722: Peptidase_C26" amino acids 71 to 171 (101 residues), 29 bits, see alignment E=9e-11

Best Hits

Swiss-Prot: 56% identical to TRPG_VIBCH: Anthranilate synthase component 2 (trpG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 100% identity to saz:Sama_2130)

MetaCyc: 48% identical to PhnB anthranilate synthase subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.27

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7H9 at UniProt or InterPro

Protein Sequence (199 amino acids)

>Sama_2130 anthranilate synthase component II (RefSeq) (Shewanella amazonensis SB2B)
MKLYLLDNFDSFTYNLVDQFRALGFEVVIYRNDVDPQQLAAKLLAEPQTALVLSPGPGAP
HEAGCMMALIKLVAGKLPILGICLGHQALVEHYGGKVERAPSVVHGKASPTVHDGQGIFR
GLPSPLPVARYHSLVATKVPDALKVIATTEGMPMAVLHEEDKALGFQFHPESILTTLGST
LLVQSLQYLTGLAAKGELQ