Protein Info for Sama_2127 in Shewanella amazonensis SB2B

Annotation: Sua5/YciO/YrdC/YwlC family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family" amino acids 7 to 204 (198 residues), 230.3 bits, see alignment E=6.4e-73 PF01300: Sua5_yciO_yrdC" amino acids 23 to 198 (176 residues), 169.9 bits, see alignment E=2.1e-54

Best Hits

Swiss-Prot: 69% identical to YCIO_ECOL6: Uncharacterized protein YciO (yciO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07566, putative translation factor (inferred from 100% identity to saz:Sama_2127)

Predicted SEED Role

"Hypothetical YciO protein, TsaC/YrdC paralog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7H6 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Sama_2127 Sua5/YciO/YrdC/YwlC family protein (RefSeq) (Shewanella amazonensis SB2B)
MSQFFYVHEVNPQKRLIDQAVNILRSGGVIVYPTDSGYALGCLIGDKNAMERIVRIRQME
QDHHFSLMCRDLSEIATYARVENQAFRLVKHCTPGPYTFIFKATKEVPRRLQNDKKKTIG
IRVPDNVIALALLEALGEPLMSTSLVMPGQEFAESDPEHIRDLLEHQVEAILNGGYLGES
PTTVVDMSEDTFEVLREGAGDISPFL