Protein Info for Sama_2095 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 59 to 85 (27 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 147 to 172 (26 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 362 to 387 (26 residues), see Phobius details amino acids 421 to 439 (19 residues), see Phobius details PF13726: Na_H_antiport_2" amino acids 3 to 88 (86 residues), 108.3 bits, see alignment E=1.8e-35 PF03553: Na_H_antiporter" amino acids 151 to 434 (284 residues), 246.2 bits, see alignment E=4.7e-77

Best Hits

Swiss-Prot: 66% identical to Y2115_VIBPA: Uncharacterized membrane protein VP2115 (VP2115) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K07084, (no description) (inferred from 100% identity to saz:Sama_2095)

Predicted SEED Role

"Histidine permease YuiF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7E4 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Sama_2095 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MMNSVVIAVCLMLALSLARVNVVIALTISALVAGLWGGMGLTATIDVFNTGLGGGAQIAL
SYALLGAFAVALSHSGLTTVISRAVIKKLGRENDAKALGTVRMLLLVSLLAMAMASQNIL
PIHIAFIPILVPPLLHLMSKLKLDRRLVACVLTFGLVTTYMVLPVGFGGIFLNDILLANL
TGNGLEASREQVPGAMLIPALGMILGLLIAVFISYRKPRNYVEEKILAAEPEERIQGRSL
IIAAVAIVATLVVQLQTDSMIFGALIGFMVFSLSGAIKHVADQDIFTQGVRMMANIGFIM
IAAAGFAAVVKATGDVGNLVSSLGELIGDNKALAAFLMLLVGLLITMGIGSSFSTIPIIA
TIYVPLALSFGFSVPATIALVGTAAALGDAGSPASDSTLGPTAGLNADGQHDHMRDSVIP
TFIHYNIPLLVFGWIAAMVL