Protein Info for Sama_2054 in Shewanella amazonensis SB2B

Annotation: arginyl-tRNA-protein transferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF04376: ATE_N" amino acids 16 to 84 (69 residues), 76.6 bits, see alignment E=1.4e-25 PF04377: ATE_C" amino acids 103 to 224 (122 residues), 127.8 bits, see alignment E=3.8e-41

Best Hits

Swiss-Prot: 100% identical to BPT_SHEAM: Aspartate/glutamate leucyltransferase (bpt) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00685, arginine-tRNA-protein transferase [EC: 2.3.2.8] (inferred from 100% identity to saz:Sama_2054)

MetaCyc: 38% identical to leucylD,E-transferase (Vibrio vulnificus CMCP6)
RXN-17898 [EC: 2.3.2.29]; 2.3.2.29 [EC: 2.3.2.29]

Predicted SEED Role

"Arginine-tRNA-protein transferase (EC 2.3.2.8)" in subsystem Protein degradation (EC 2.3.2.8)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.29 or 2.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7A3 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Sama_2054 arginyl-tRNA-protein transferase (RefSeq) (Shewanella amazonensis SB2B)
MESSTHVSVGISQLFQCSYLEDQQEQLLIIQEPFLDPLLFERLLQLGFRRSGDAIYKPRC
PSCSACIALRVPVRSFQPSKRQKRTLAKNKDLTVNWVNESSDEHYALYEKYINLRHFDGP
MFPASREQYEHFVLCDWAPPGFVELRLEGKLLAVAVTDVLPTSLSAIYSFFDPDFDARSL
GSQLILTQMALAADMDKAFVYLGYQIDANRKMCYKRLYRPYQILTQNGWEFHTNANL