Protein Info for Sama_2051 in Shewanella amazonensis SB2B
Annotation: hypothetical protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
KEGG orthology group: None (inferred from 100% identity to saz:Sama_2051)Predicted SEED Role
"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)
MetaCyc Pathways
- 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Lysine degradation
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.61
Use Curated BLAST to search for 2.3.1.61
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A1S7A0 at UniProt or InterPro
Protein Sequence (134 amino acids)
>Sama_2051 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B) MSNMTKEEVISALEAALEQAEGRKVSIEQKGSWFKIDGGKSLRFAELEAMLAEHSGGAAN APKATKPEPAAKAAPKANAKPELQAEPKAAAKPKTAPKTAAKPATPPGSGGLLPKDLWKQ QLLAKGNTLPRGVK