Protein Info for Sama_2027 in Shewanella amazonensis SB2B

Annotation: peptidylprolyl isomerase, FKBP-type (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00254: FKBP_C
  • amino acids 3 to 80 (78 residues), 39.7 bits, E=2.6e-14

Best Hits

Swiss-Prot: 44% identical to SLYD_ECO57: FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (slyD) from Escherichia coli O157:H7

KEGG orthology group: K03775, FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC: 5.2.1.8] (inferred from 100% identity to saz:Sama_2027)

MetaCyc: 44% identical to FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]; RXN-22956 [EC: 5.2.1.8]

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase SlyD (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (5/10 steps found)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

See A1S776 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Sama_2027 peptidylprolyl isomerase, FKBP-type (RefSeq) (Shewanella amazonensis SB2B)
MEIKDDLVVQFNYTLRDEKGEVIETNEGHDPIAYLHGHDNMMPGVENAIAGKKVGDKFSV
TLPASETYGERIENAEQRVPSKHLMGAKVWKPGMRAIINTDQGQRQVTVVKVGKFMVTVD
INHPLAGRELTFDIEIVDAREASAEEIAHGHAHGVGGHHH