Protein Info for Sama_2019 in Shewanella amazonensis SB2B

Name: ilvH
Annotation: acetolactate synthase 3 regulatory subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00119: acetolactate synthase, small subunit" amino acids 1 to 159 (159 residues), 211 bits, see alignment E=4.5e-67 PF01842: ACT" amino acids 4 to 68 (65 residues), 57 bits, see alignment E=1.9e-19 PF13710: ACT_5" amino acids 11 to 73 (63 residues), 57.6 bits, see alignment E=1.4e-19 PF10369: ALS_ss_C" amino acids 84 to 158 (75 residues), 91.7 bits, see alignment E=3.9e-30

Best Hits

Swiss-Prot: 71% identical to ILVH_SALTY: Acetolactate synthase isozyme 3 small subunit (ilvH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 100% identity to saz:Sama_2019)

MetaCyc: 70% identical to acetolactate synthase / acetohydroxybutanoate synthase, regulatory subunit (Escherichia coli K-12 substr. MG1655)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S768 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Sama_2019 acetolactate synthase 3 regulatory subunit (RefSeq) (Shewanella amazonensis SB2B)
MRRIISVLLENQPGALSRVVGLFSQRGYNIECLTVAPTDDATLSRMNITVAADEMVLEQI
EKQLHKLIDVLKVSNITESAHIERELALVKVKAQSEVREEIKRSADIFRGQIVDVTASHY
TIQLAGTTEKLDAFINALAEVTKVVEVSRSGVVGLSRGDKSMRA