Protein Info for Sama_2002 in Shewanella amazonensis SB2B

Annotation: sortase (surface protein transpeptidase)-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03784: sortase, marine proteobacterial type
  • amino acids 18 to 193 (176 residues), 214 bits, E=1.2e-67
• PF04203: Sortase
  • amino acids 82 to 195 (114 residues), 96.3 bits, E=5.7e-32
• TIGR01076: sortase
  • amino acids 87 to 184 (98 residues), 53.9 bits, E=1.6e-18

Best Hits

KEGG orthology group: K07284, sortase A (inferred from 100% identity to saz:Sama_2002)

Predicted SEED Role

"LPXTG-site transpeptidase family protein"

Sequence Analysis Tools

See A1S751 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Sama_2002 sortase (surface protein transpeptidase)-like protein (RefSeq) (Shewanella amazonensis SB2B)
MKRLRFGPRHRRRWPLLLLLSGVVLISFGGYMQAKALLAQYLIASAWEQSLKDGLPHKPW
GWADTHPIARLELRRAGESSESFYILAGANGRNLAFAPSWLEDTAAPGAGGNTVIAGHRD
THFAILREVEPGDELLLENMHGELQQYRVKYTSVVSERELSVLEQVTDRLTLITCYPFYG
LSDRANERFVVVAEPDDLWSRPDTAAKAMVVSLR