Protein Info for Sama_1971 in Shewanella amazonensis SB2B

Name: rrmA
Annotation: 23S rRNA methyltransferase A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF21302: Zn_ribbon_RlmA" amino acids 10 to 53 (44 residues), 76.3 bits, see alignment 3.6e-25 PF01209: Ubie_methyltran" amino acids 91 to 192 (102 residues), 22.2 bits, see alignment E=2e-08 PF13847: Methyltransf_31" amino acids 93 to 208 (116 residues), 49.2 bits, see alignment E=1.2e-16 PF13649: Methyltransf_25" amino acids 95 to 182 (88 residues), 46.1 bits, see alignment E=1.7e-15 PF08241: Methyltransf_11" amino acids 96 to 185 (90 residues), 42.5 bits, see alignment E=2.2e-14

Best Hits

Swiss-Prot: 49% identical to RLMA_ECOLI: 23S rRNA (guanine(745)-N(1))-methyltransferase (rlmA) from Escherichia coli (strain K12)

KEGG orthology group: K00563, 23S rRNA (guanine745-N1)-methyltransferase [EC: 2.1.1.187] (inferred from 100% identity to saz:Sama_1971)

MetaCyc: 49% identical to 23S rRNA m1G745 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11573 [EC: 2.1.1.187]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase A (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.187, 2.1.1.51

Use Curated BLAST to search for 2.1.1.187 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S720 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Sama_1971 23S rRNA methyltransferase A (RefSeq) (Shewanella amazonensis SB2B)
MVAQNIQPIYLCPLCKASLQSETTGLVCPAGHRFDKAKEGYVNLLPVQKKKSKDPGDNKE
MMQARRLFLESGSYQALSDRVGELVLGLPVSPATILDLGCGEGYYTHRLQQVLAKEDIWP
QLYGLDISRAALKAAAKRYPQIHFCVASSFDTPFASEFFDLVVRIYAPSKPEELKRLVKP
GGHLLTVSAGPMHHFAVKQRIYDTPRLHEDSVEQIDGFEIVSSERLQWQLEMENPELILA
FLEMTPYAWKFTPEARTQLAGEPFSCELDFRINLQRRVL