Protein Info for Sama_1884 in Shewanella amazonensis SB2B

Annotation: hydroxyacylglutathione hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 4 to 258 (255 residues), 307.8 bits, see alignment E=2.5e-96 PF00753: Lactamase_B" amino acids 15 to 170 (156 residues), 63.5 bits, see alignment E=2.8e-21 PF16123: HAGH_C" amino acids 171 to 258 (88 residues), 101.7 bits, see alignment E=2.4e-33

Best Hits

Swiss-Prot: 100% identical to GLO2_SHEAM: Hydroxyacylglutathione hydrolase (gloB) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 100% identity to saz:Sama_1884)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6T3 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Sama_1884 hydroxyacylglutathione hydrolase (RefSeq) (Shewanella amazonensis SB2B)
MLDIRPIPAFADNYIWMIVLPDGGAVVVDPGDAMPVINTLQRLNLQLTAVLLTHHHRDHN
GGINQLRDWAKSNGQSFTVYGAVTSDYSDVLCRDGDTVDISGLTSPVRVLSVPGHTLDHL
AFVVDNALFCGDTLFSGGCGRLFEGDAGQLYDSLAKLASLPDDTLVYCAHEYTLSNLRFA
LAVEPQNQCLQDYVKQVNNLREANKPSLPSTLGTEKAINPFLRVDTATVHAAVAAQAGQK
VPDEVTCLALLRRWKDNF