Protein Info for Sama_1866 in Shewanella amazonensis SB2B

Annotation: putative two-component system sensor kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 17 to 45 (29 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details PF16750: HK_sensor" amino acids 45 to 151 (107 residues), 92.4 bits, see alignment E=5.8e-30 PF00672: HAMP" amino acids 177 to 231 (55 residues), 26 bits, see alignment 2.4e-09 PF00512: HisKA" amino acids 237 to 299 (63 residues), 52.8 bits, see alignment E=8.3e-18 PF02518: HATPase_c" amino acids 347 to 457 (111 residues), 88.3 bits, see alignment E=1.2e-28 PF13589: HATPase_c_3" amino acids 353 to 426 (74 residues), 25.2 bits, see alignment E=3.6e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1866)

Predicted SEED Role

"Probable two-component system sensor kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6R5 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Sama_1866 putative two-component system sensor kinase (RefSeq) (Shewanella amazonensis SB2B)
MKLSRHHPFARLQWRLFGYFGSSLLVILLLASLIEAMVLHQLLVLPKETKAKLSMLAQEA
EALIKQGSPQAIAQWEAAQSFRLHVINSRLEGVSGRPIHPHFEFKLGFMLGPDQALGDRV
QKPIIGLPIYATLDGSGPLLLAVQLNADLHPAKDLSYSLWAIRLTVGLFVLWLFSRLLGH
YLIKPLATLQQGTRALASGKLSTRIGEHFSAAEPEFYQLGHDFDEMADVIERTLTTQERL
IRDVSHELRTPLARQKLAAELLESDLADTSPYLKRIHAENSELSRLIDTLLGYSRLASGY
QAARSTSFTLHELACSLLGDCRFEAAPTQSIEWQALSACKYIALETDQSLLLRALENLVR
NSLKYAGTECHIQISSHCDDSWLTITVEDDGPGIDDTKLETLFHPFTRFDEARHASQGGF
GLGLAIVRECMRLLGGDVSAGRSELGGLEVKLLLPMRLKRLAATDKAI