Protein Info for Sama_1842 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 237 (237 residues), 328.8 bits, see alignment E=1.2e-102 PF20772: TACO1_YebC_N" amino acids 5 to 76 (72 residues), 111.3 bits, see alignment E=2.6e-36 PF01709: Transcrip_reg" amino acids 83 to 237 (155 residues), 200.2 bits, see alignment E=1.8e-63

Best Hits

Swiss-Prot: 77% identical to Y2432_SHEON: Probable transcriptional regulatory protein SO_2432 (SO_2432) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1842)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6P1 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Sama_1842 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MAGHSKWANIRHRKAAQDAKRGKLFTKLIRELVVSAREGGSDADANPRLRAAIDKALSAN
MTRDTVERAVKRGSGELDGDNLETLIYEGYGPGGTAVMVECMTDNRNRAVTGVRNAFNKS
GGNLGTDGSVAYLFTKRGVISFEAGTDEDAMMEAALDAGADDVIINDDGSADVYTTPEDF
GAVKDALDGTGFSSVNAEVTMVPSTRAVLDAETAPKFLRLIDQLEDHDDVQEVYHNADIP
DEVMETLE