Protein Info for Sama_1839 in Shewanella amazonensis SB2B

Name: ruvB
Annotation: Holliday junction DNA helicase RuvB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF05496: RuvB_N" amino acids 23 to 181 (159 residues), 272.4 bits, see alignment E=2.8e-85 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 27 to 329 (303 residues), 482.4 bits, see alignment E=2.4e-149 PF07728: AAA_5" amino acids 57 to 175 (119 residues), 30.6 bits, see alignment E=7.7e-11 PF00004: AAA" amino acids 58 to 179 (122 residues), 75.7 bits, see alignment E=1.2e-24 PF17864: AAA_lid_4" amino acids 184 to 257 (74 residues), 111.7 bits, see alignment E=2.7e-36 PF05491: WHD_RuvB" amino acids 259 to 328 (70 residues), 85.7 bits, see alignment E=4.2e-28

Best Hits

Swiss-Prot: 100% identical to RUVB_SHEAM: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 100% identity to saz:Sama_1839)

MetaCyc: 78% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6N8 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Sama_1839 Holliday junction DNA helicase RuvB (RefSeq) (Shewanella amazonensis SB2B)
MIEADRLIQPQDLGQEDVIDRAMRPKLLDEYTGQDDTRAQLKVFIEAAKKRGEALDHMLI
YGPPGLGKTTLANIVANEMGVNIKSTSGPVLEKAGDLAALLTNLEEGDVLFIDEIHRLSP
VVEEILYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVGATTRAGSLTSPLRARFGIPLR
LEFYNVRDLSSIVARSAKVMDVPMDEGGAEEIARRSRGTPRIANRLLRRVRDFAEVKHDG
AISRAVAQSALDLLDVDSEGFDYMDRKLLLAIIDKFMGGPVGLDNLAAAIGEERETIEDV
LEPFLIQQGFVQRTPRGRIATARAYSHFDLIKPD