Protein Info for Sama_1827 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details TIGR03902: rhombosortase" amino acids 38 to 189 (152 residues), 175 bits, see alignment E=5.1e-56 PF01694: Rhomboid" amino acids 50 to 193 (144 residues), 37.7 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1827)

Predicted SEED Role

"Rhombosortase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6M6 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Sama_1827 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MSPTPLSNLLPSIDKQLVMVGALLSALCAALYLLPIDSQLNWQRSQIGAGEYWRLISGNL
LHTNHWHLLMNLAGFWVILSLHHFHYRATGLLLLLFALCLGEGVGLYLCYPSLHAYVGLS
GILHGLFAFGSLMDIERGLRSGWLLLLGLGLKVGYEQYFGASSDVASLIGARVATESHLV
GALVGTVLGAAYLAVRKLKQAKVYG