Protein Info for Sama_1811 in Shewanella amazonensis SB2B

Annotation: 6-phosphogluconolactonase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR01198: 6-phosphogluconolactonase" amino acids 10 to 224 (215 residues), 190.4 bits, see alignment E=1.8e-60 PF01182: Glucosamine_iso" amino acids 12 to 222 (211 residues), 197 bits, see alignment E=2.1e-62

Best Hits

Swiss-Prot: 41% identical to 6PGL_PSEAE: 6-phosphogluconolactonase (pgl) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 100% identity to saz:Sama_1811)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6L0 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Sama_1811 6-phosphogluconolactonase (RefSeq) (Shewanella amazonensis SB2B)
MLKEAVFKSFDNTDSLETQLADRIARQLQDAVDARGKASLVVSGGSTPLKLFKALSNKAI
DWNEVFVTLADERWVDNAHKDSNERLVRENLLQNRAASAKFRGLKNMFASAEEGAAMTSE
HLANVPRPFDVVVLGMGNDGHTCSWFPCSDDLMRALDSDALCEAVTPRTAPHERITLTKK
AILNSRQIYLHLVGEQKLSVYRQALESDDIKAMPIRVVLGQHKTPVDVYWSA