Protein Info for Sama_1799 in Shewanella amazonensis SB2B

Annotation: fumarate/nitrate reduction transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00027: cNMP_binding" amino acids 51 to 132 (82 residues), 54.8 bits, see alignment E=1.1e-18 PF13545: HTH_Crp_2" amino acids 168 to 241 (74 residues), 62.5 bits, see alignment E=4.4e-21 PF00325: Crp" amino acids 193 to 224 (32 residues), 56.3 bits, see alignment 3e-19

Best Hits

Swiss-Prot: 90% identical to ETRA_SHEON: Electron transport regulator A (etrA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 100% identity to saz:Sama_1799)

Predicted SEED Role

"Fumarate and nitrate reduction regulatory protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6J8 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Sama_1799 fumarate/nitrate reduction transcriptional regulator (RefSeq) (Shewanella amazonensis SB2B)
MPIEQNKHRRPAATGCTIHCHDCSMGTLCIPFTLNANELDQLDNIIERKKPIQKGEQIFK
SGDSLKSLYAIRSGTIKSYTITEQGDEQITGFHLAGDVIGFDGIHANTHQSFAQALETSM
VCEIPFNTLDELSGSMPKLRQQIMRLMSNEIMSDQEMILLLSKKNAEERLAAFIANLATR
YGNRGFSQREFRLTMTRGDIGNYLGLTVETISRLLGRFQKSELIEVKGKYITIIDFAGLN
TLAGNARIAR