Protein Info for Sama_1785 in Shewanella amazonensis SB2B

Annotation: MerR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF00376: MerR" amino acids 6 to 43 (38 residues), 57.6 bits, see alignment E=1.3e-19 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 6 to 130 (125 residues), 158.5 bits, see alignment E=4.1e-51 PF13411: MerR_1" amino acids 6 to 71 (66 residues), 64 bits, see alignment E=1.7e-21 PF09278: MerR-DNA-bind" amino acids 49 to 111 (63 residues), 66.9 bits, see alignment E=2.9e-22

Best Hits

Swiss-Prot: 47% identical to HMRR2_RHIME: Heavy metal-dependent transcription regulator 2 (hmrR2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1785)

Predicted SEED Role

"Cu(I)-responsive transcriptional regulator" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6I4 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Sama_1785 MerR family transcriptional regulator (RefSeq) (Shewanella amazonensis SB2B)
MSTLLTIGEAAKTSGLSTKMIRHYEQTGLLKKSPRTDSGYRLYNNEQINQLRFIRQARNL
GFSLNDIQSLLGLWQDPNRESRLVKQLATQHLDDIKMKISELQHMQLILTELAESCCGDE
NPHCSILQKLAKPD