Protein Info for Sama_1782 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details PF01027: Bax1-I" amino acids 16 to 212 (197 residues), 184.7 bits, see alignment E=9.5e-59

Best Hits

Swiss-Prot: 55% identical to Y1358_VIBCH: Uncharacterized membrane protein VC_1358 (VC_1358) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06890, (no description) (inferred from 100% identity to saz:Sama_1782)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6I1 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Sama_1782 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MSQEILVSKQSTLEVNKLIKNTYMLLSMTLAFSALCAWIATAMGISPLMSLGFAIGGFIL
LFVTLRKADTAAGLFWVFAFTGMEGASLGFILNHYAGMANGPELIMQAFGLTSAIFIGLS
MYALTTKKDFSFMGGFLFAGLIVIVIGGLINLFVGNSTAYMLLSWATALVFTGLILFDTS
RIVNGGETNYIRATVSLYLDFLNLFLAILRILGMNNDD