Protein Info for Sama_1775 in Shewanella amazonensis SB2B

Annotation: crcB protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details PF02537: CRCB" amino acids 5 to 116 (112 residues), 102.7 bits, see alignment E=6.7e-34 TIGR00494: protein CrcB" amino acids 5 to 119 (115 residues), 110 bits, see alignment E=4.2e-36

Best Hits

Swiss-Prot: 100% identical to CRCB_SHEAM: Putative fluoride ion transporter CrcB (crcB) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to saz:Sama_1775)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6H4 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Sama_1775 crcB protein (RefSeq) (Shewanella amazonensis SB2B)
MNNVLYIAAGGAIGAVLRYSISILALQLFGTGFPFGTLIVNVAGSFLMGCIYALAELSHI
GPEWKALIGVGLLGALTTFSTFSNETLLLLQQGELVKASLNVLLNLILCLTVVYLGQQLI
YSRV