Protein Info for Sama_1771 in Shewanella amazonensis SB2B

Annotation: leucine-responsive transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF13412: HTH_24" amino acids 12 to 58 (47 residues), 72.3 bits, see alignment E=2.8e-24 PF13404: HTH_AsnC-type" amino acids 12 to 53 (42 residues), 68.9 bits, see alignment E=3.9e-23 PF01037: AsnC_trans_reg" amino acids 76 to 158 (83 residues), 93.1 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 81% identical to LRP_KLEPN: Leucine-responsive regulatory protein (lrp) from Klebsiella pneumoniae

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to saz:Sama_1771)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6H0 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Sama_1771 leucine-responsive transcriptional regulator (RefSeq) (Shewanella amazonensis SB2B)
MAYNKKNPVKDLDRIDRNILNELQIDGRISNVELSKRVGLSPTPCLERVKRLEKQGYING
YTALVNPHYLGASLLVFVEITLNRDTPEVFDRFNRAVQLLDDIQECHLVSGDFDYLLKTR
VSDMSAYRKLLGETLLKLPSVSDTRTYVVMEEVKQTNKVAVNNISDK