Protein Info for Sama_1758 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details PF08019: EptA_B_N" amino acids 52 to 202 (151 residues), 162.7 bits, see alignment E=5.9e-52 PF00884: Sulfatase" amino acids 230 to 518 (289 residues), 201.1 bits, see alignment E=2.6e-63

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 100% identity to saz:Sama_1758)

Predicted SEED Role

"Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6F7 at UniProt or InterPro

Protein Sequence (538 amino acids)

>Sama_1758 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MKSIGLNRFTFFIALYYAAILNIPLYIRAAEGLKSLSHIDWLFVASLPVLLTSLLALIFS
LFSVKYLVKPFFILLTLVSALVVFGMYKYGIVFDRAMMENIFETHSAEAFMYLNTESVVG
FLLLGILPAFLIAKVKIEYRVWWKELLVKSGFMLGMVSIAGGVLAGYYQDYVAFGRNNDD
MKQLVVPTYYIGAAAGFVNQRYIETPLEYQPLGTDANNQTRDSNQKPLLTVLLVGETARS
MNYQYYGYQKDTNAFTKPHNPIVLSATRSCGTATAQSLPCMFSRMGREDYNARKARAQDT
VIDVLDHAGVTVYWIDSDSGCKGVCDRVINETVKLDEDPALCDGESCLDQVLLNRLDNIL
ASPIEKDTLLVLHIMGSHGPTYFQRYPDEHKAFTPDCPRSDIQNCSNEALVNTYDNTIRY
SDYIMAEVINRLKQQEPVADTAMMYISDHGESLGEKGLYLHGAPYAFAPIEQISVPWLLW
LSDGFKEENRLDESCLRSLQGEWSHDNLFDSLLGWMNIHTSIYRKELDIFSRCRLPAV