Protein Info for Sama_1753 in Shewanella amazonensis SB2B

Annotation: putative RNA methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details PF00588: SpoU_methylase" amino acids 2 to 150 (149 residues), 94.9 bits, see alignment E=2.5e-31 TIGR00050: RNA methyltransferase, TrmH family, group 1" amino acids 2 to 194 (193 residues), 197.3 bits, see alignment E=1.8e-62

Best Hits

KEGG orthology group: K02533, tRNA/rRNA methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to saz:Sama_1753)

Predicted SEED Role

"tRNA:Cm32/Um32 methyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6F2 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Sama_1753 putative RNA methyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MLSVVLVEPARAANVGAAARAMKTMGFTQLILIGSQPHLEDEARWVAHGATDILDNARVL
DSFDDLRAEFDLLIATTARERGSPRTFLNPEELAITLGQSGAQSMALVFGRESSGLSNQE
LSQCDLFSYVPLAGDYPSLNLGQAVMVYTYALSGVERTIGLQTRDADERQIQSLKHKANE
LANQLGLSEQDKLRPWLQDSIGRLSERDCKLAHQLISDIMSKING