Protein Info for Sama_1743 in Shewanella amazonensis SB2B

Updated annotation (from data): Acyl-CoA dehydrogenase (EC 1.3.8.-)
Rationale: Specifically important in carbon source Tween 20. This confirms that it is an acyl-CoA dehydrogenase and not a biosynthetic acyl-ACP dehydrogenase (as suggested by KEGG). Since Tween 20 is hydrolyzed to a C12 fatty acid, this may act on long chain acyl-CoAs, or it might act on medium-chain acyl-CoA intermediates.
Original annotation: acyl-CoA dehydrogenase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 502 to 522 (21 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 81 to 159 (79 residues), 42.8 bits, see alignment E=2.2e-14 PF02770: Acyl-CoA_dh_M" amino acids 163 to 269 (107 residues), 57.6 bits, see alignment E=4.1e-19 PF00441: Acyl-CoA_dh_1" amino acids 279 to 441 (163 residues), 77.1 bits, see alignment E=6e-25 PF22924: ACOX_C_alpha1" amino acids 288 to 438 (151 residues), 35.5 bits, see alignment E=3.1e-12 PF08028: Acyl-CoA_dh_2" amino acids 295 to 437 (143 residues), 30.5 bits, see alignment E=1.4e-10 PF12806: Acyl-CoA_dh_C" amino acids 455 to 574 (120 residues), 67.4 bits, see alignment E=4.8e-22

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to saz:Sama_1743)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.8.- or 1.3.8.7 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6E2 at UniProt or InterPro

Protein Sequence (578 amino acids)

>Sama_1743 Acyl-CoA dehydrogenase (EC 1.3.8.-) (Shewanella amazonensis SB2B)
MNPYQAPLGEMRFLLEHVFNAQATWQGLASLDGMVDMDTALAILEEAAKLNSELVHPINR
AGDEEGVGFSDGRVTTPKGYKEAYNAFVEGGWVGLSGDPEYGGMGMPKMLGVLVDEMGYS
ACNAFNLYGSLTAGAALAINAHGTEELKSTYLPKLYSGEWAGAMDMTEPQAGSDLRHIRT
RAEPQEDGSYLITGSKIFITGGDQDLTENVIHLVLAKISGSNTLSLFLVPKIGVDDQGNL
TEPNGVSVGSIEHKMGLKGSATCVMNFDSARGWLIGRENKGLACMFTMMNYERLAIGIQG
LGSAQAAVQMASDYARERLQGNAVGSTAAADPILVHGDVRRMLLTTRTLTDAGRALAVHT
GKQLDLAKFADDDAVKTKAGRYVGLLTPVAKAFLTDRGLDITIMAQQVFGGHGYIRETGI
EQLVRDTRIAQIYEGTNGIQAIDFLGRKVTGDNLATVKEFIAEHIEVLSDTCDKANSLRV
GFADFVAVATWINDNKLSRPALINSVAVEMLDAFGYLLYGYYHLLMRDAARAADSEFAAA
KAAYCDYYFAKLMPRADALLRAAKAGDELLMSLPETCF