Protein Info for Sama_1736 in Shewanella amazonensis SB2B

Name: rpsA
Annotation: 30S ribosomal protein S1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 TIGR00717: ribosomal protein bS1" amino acids 3 to 520 (518 residues), 763 bits, see alignment E=6.9e-234 PF00575: S1" amino acids 18 to 86 (69 residues), 23.7 bits, see alignment E=1.1e-08 amino acids 105 to 171 (67 residues), 35.7 bits, see alignment E=1.9e-12 amino acids 190 to 260 (71 residues), 77.2 bits, see alignment E=2.1e-25 amino acids 275 to 347 (73 residues), 71.6 bits, see alignment E=1.2e-23 amino acids 361 to 434 (74 residues), 73.4 bits, see alignment E=3.2e-24 amino acids 449 to 520 (72 residues), 61.9 bits, see alignment E=1.2e-20 PF21710: Spt6_S1" amino acids 450 to 523 (74 residues), 28.1 bits, see alignment E=4.2e-10

Best Hits

Swiss-Prot: 85% identical to RS1_SHIFL: 30S ribosomal protein S1 (rpsA) from Shigella flexneri

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 100% identity to saz:Sama_1736)

MetaCyc: 85% identical to 30S ribosomal subunit protein S1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6D5 at UniProt or InterPro

Protein Sequence (555 amino acids)

>Sama_1736 30S ribosomal protein S1 (RefSeq) (Shewanella amazonensis SB2B)
MTESFADLFEQSLQQLEFRPGSIVRGTVVAIENGLVLVDAGLKSESPIPAEQFKNAQGVL
EIAVGDQVDVALDSVEDGFGETQLSREKAKRHEAWIVLEKAYEDAETVIGIINGKVKGGF
TVELNGIRAFLPGSLVDVRPVRDTAHLENKELEFKVIKLDQKRNNVVVSRRAVIESESSA
ERDALLENLQEGQAVKGIVKNLTDYGAFVDLGGVDGLLHITDMAWKRVKHPSEIVNVGDE
INVKVLKYDRERTRVSLGLKQLGEDPWLEISKRYPENTRLTGRVTNLTDYGCFVEIEEGV
EGLVHVSEMDWTNKNIHPSKVVNLGDEVEVLVLDIDEERRRISLGLKQCKTNPWEDFANR
YNKGDKVSGKIKSITDFGIFIGLDGGIDGLVHLSDISWNATGEEAVSEYKKGDEIEAVVL
SVDPERERISLGVKQTEDDPFNGYVGDKKKGAIVNGTVTAVDAKGVTVELAEGVEGYIRV
ADISRERVEDASTVFSVGDAVEAKFMGVDRKNRNVSLSIRAKDEADEKEVMANLNKQEDA
VISNAMAEAFKAARK