Protein Info for Sama_1727 in Shewanella amazonensis SB2B

Name: nrdB
Annotation: ribonucleotide-diphosphate reductase subunit beta (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00268: Ribonuc_red_sm
  • amino acids 48 to 347 (300 residues), 167 bits, E=3e-53

Best Hits

Swiss-Prot: 79% identical to RIR2_HAEIN: Ribonucleoside-diphosphate reductase subunit beta (nrdB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 100% identity to saz:Sama_1727)

MetaCyc: 77% identical to ribonucleoside-diphosphate reductase 1 subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

See A1S6C6 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Sama_1727 ribonucleotide-diphosphate reductase subunit beta (RefSeq) (Shewanella amazonensis SB2B)
MLTGGFAPFYRNREIMAYTTFCQTPNDATREPMFFGQSVNVARYDQQRYEVFEKLIEKQL
SFFWRPEEVDVSRDKIDFGKLPDHERHIFISNLKYQTLLDSIQGRSPNVAFLPLVSLPEL
ETWIETWSFSETIHSRSYTHIIRNIVNDPSSVFDDIVVNEEILKRAGDISAYYDELIKLT
QIYHLHGEGTHTVDGHVVDVTVRALKKALYLCMMSVNALEAIRFYVSFACSFAFAERKLM
EGNAKIIRLIARDEALHLNSTQHILNIMQGGKDDAEMAEIAIECQQEAYDLFLRAAEQEK
EWAKYLFKDGSMIGLNEQILCQYVEYITNQRMKSVNLPLPYPESTNPLPWMKNWLESDAV
QVAPQEVEVSSYLVGQIDASVDENEFSDFDL