Protein Info for Sama_1723 in Shewanella amazonensis SB2B

Annotation: signal peptide peptidase SppA, 67K type (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 16 to 609 (594 residues), 615.1 bits, see alignment E=1.2e-188 PF01343: Peptidase_S49" amino acids 139 to 284 (146 residues), 99.9 bits, see alignment E=1.5e-32 amino acids 394 to 543 (150 residues), 159.9 bits, see alignment E=4.7e-51 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 352 to 543 (192 residues), 177.6 bits, see alignment E=2.5e-56

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 100% identity to saz:Sama_1723)

Predicted SEED Role

"Signal peptide peptidase SppA (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6C2 at UniProt or InterPro

Protein Sequence (617 amino acids)

>Sama_1723 signal peptide peptidase SppA, 67K type (RefSeq) (Shewanella amazonensis SB2B)
MAKKPLTTKNTLLLIWNTINFVRKLIINIVFFPILILVLIVGIVALSTEDELRIESGSAL
VLDLSGNLVDQARRVDPLTQLMRQGNQNSEDTEVLLSDVLYVIENATHDERIGAIVLDLG
NMRAGISKLTAVGEALNGFRETGKKVVAIGDWYSRSQYFLASYADEIYLNPRGEVFIDGY
AAYNLYFKSALEKLKVNTHVFRVGTYKSAVEPYIRDDMSPAAKEATQLLIDDLWGSYADT
VAKNRGIETGELVLDADTYLARLDANDGDSAALAVKQGWVDALMSDEAFRSAMVELVGED
KEEHSFRQVGFHEYHKLVKPQPQFMPVDSVGVIVAKGTILNGFQAPGDIGGKSTSQLIRD
ARFDDSIKALVLRVDSPGGSAFASEEIRQELLALKAAGKPVVVSMGSMAASGGYWISASA
DYIYATPTTLTGSIGIFGLMTTFEDSLAAIGVHADGVATSEWAAHSPFRPLSPKLESAIQ
RNIERGYKEFITLVANERDMTLEQVDAIAQGRVWSGKKALELGLVDEIGDMPQALAKAAE
LAGMATFDIQLIEQQMSPEELFIQEMFASVSAWLPQQTQQSDVVQSLLRVWTRTLQEIAR
FDDPKGVYLYCEYCQLQ