Protein Info for Sama_1704 in Shewanella amazonensis SB2B

Annotation: alpha/beta fold family hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF12697: Abhydrolase_6" amino acids 16 to 244 (229 residues), 73.8 bits, see alignment E=8.3e-24 PF00561: Abhydrolase_1" amino acids 16 to 242 (227 residues), 102.1 bits, see alignment E=1e-32 PF12146: Hydrolase_4" amino acids 16 to 238 (223 residues), 37.8 bits, see alignment E=3.5e-13 PF00756: Esterase" amino acids 46 to 108 (63 residues), 30.8 bits, see alignment E=6.7e-11

Best Hits

Swiss-Prot: 35% identical to ABHDB_XENTR: Protein ABHD11 (abhd11) from Xenopus tropicalis

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to saz:Sama_1704)

Predicted SEED Role

"Esterase ybfF (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6A4 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Sama_1704 alpha/beta fold family hydrolase (RefSeq) (Shewanella amazonensis SB2B)
MSAQLNYQTQGVGEDVVLVHGLFGDLDNLKGLAQTLESEYRVTRIDVPNHGQSPHWDTMD
YPSLAQSLVSLLDELGATKAHLIGHSMGGKIVLATALLHPDRVASVVAADIAPVPYAPRH
QRVFAALTSLPLDGSVERKEALNHLLARGVDEATAQFLLKSFRRAESGFSWRMNLDGLIA
SYEGIIGWPFNNGAYDGPTLFIRGDESDYVTAEHKDAILSQFPNVQLKSIGGAGHWLHAQ
KPGIFNRLVKNFLDSQHPELHG